PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016490738.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 839aa    MW: 93886.4 Da    PI: 10.0051
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016490738.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B337.34.7e-1227116198
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+    + ++++rl++p +fa+ + ++  +   + le +sg++Wev++    ++g++ l+ GW++F +   +  g f++F ++ rs f  +v+
  XP_016490738.1  27 FFKII--LSQHERSRLRIPEDFASIYCKNMLN--PVYLEVPSGEVWEVEV--VHSQGQICLGIGWQDFSDFYSISRGHFLMFGYNARSHF--NVS 113
                     67777..78889999********877444334..4***************..999999**************************999999..999 PP

                     EE- CS
              B3  96 vfr 98 
                     +f+
  XP_016490738.1 114 IFD 116
                     997 PP

2B350.92.8e-16282374498
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      + ps+v++   l++  kfa+++ +++ ++  l++  +   sW+vk+  + ++      +GWk Fv +n+Lk gD++vF++++ ++    v++fr
  XP_016490738.1 282 FMQPSYVFSPFSLSIALKFARKYFLENYGNLVLRVPGRGRGSWSVKC--TTRGTNAKVHSGWKAFVLDNKLKCGDVCVFEVIKGTRLFIDVTIFR 374
                     5789*******************88888887888888888*******..66666677899********************987655556677766 PP

3B336.86.8e-12540632598
                     -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE- CS
              B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfr 98 
                     + ps+v+k   l ++  fa ++  ++ ++  l++  + + sW vk+   k++ ++ ++  Wk Fv +n+Lk gD +vF+l++  ++  l v++fr
  XP_016490738.1 540 MQPSYVSKPYSLHISLLFAVKYFRENCGNLVLRVPGSGSGSWPVKYALGKSKPKICFS--WKAFVLDNKLKFGDACVFELIKGgTKPILDVTIFR 632
                     67899999999***********65544544555555666*******988888888888..********************976566667777776 PP

4B3543.1e-17739829395
                     EE-..-HHHHT....T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
              B3   3 kvltpsdvlks....grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                     + ++++++ +s     +l++  + a+++   k++  +++l+++s rsW vk+  + +     lt+GWkeFv +n+Lk+gD++vF++++rs+   +
  XP_016490738.1 739 TCFMQPSYVSSasgpMQLSITLSRARKFFAAKHS--DVVLQNSSKRSWAVKC--SLGTVNAKLTSGWKEFVLDNNLKVGDVCVFERVSRSKL--L 827
                     5555444444446668899999999999755444..8***************..55555677***********************7766555..4 PP

                     EE CS
              B3  94 vk 95 
                     + 
  XP_016490738.1 828 FN 829
                     44 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.106.3E-1819118IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-1721118IPR015300DNA-binding pseudobarrel domain
CDDcd100171.28E-1025116No hitNo description
PROSITE profilePS5086311.27925118IPR003340B3 DNA binding domain
PfamPF023621.5E-827116IPR003340B3 DNA binding domain
SMARTSM010195.2E-928118IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.6E-21271376IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-19272375IPR015300DNA-binding pseudobarrel domain
CDDcd100172.88E-17277374No hitNo description
SMARTSM010195.2E-12278376IPR003340B3 DNA binding domain
PROSITE profilePS5086311.561279376IPR003340B3 DNA binding domain
PfamPF023623.1E-13282374IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-16528633IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-16529632IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-11535634IPR003340B3 DNA binding domain
PROSITE profilePS5086310.644536634IPR003340B3 DNA binding domain
PfamPF023621.8E-9540632IPR003340B3 DNA binding domain
CDDcd100179.85E-15540632No hitNo description
Gene3DG3DSA:2.40.330.104.5E-23730833IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.58E-20733834IPR015300DNA-binding pseudobarrel domain
CDDcd100172.47E-15736833No hitNo description
SMARTSM010197.4E-10741831IPR003340B3 DNA binding domain
PROSITE profilePS5086313.084741836IPR003340B3 DNA binding domain
PfamPF023625.2E-15748828IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MAAKPHLQSG ESSSNWKSST NITQPKFFKI ILSQHERSRL RIPEDFASIY CKNMLNPVYL  60
EVPSGEVWEV EVVHSQGQIC LGIGWQDFSD FYSISRGHFL MFGYNARSHF NVSIFDLSAS  120
EIEYPYSSAH GIHTPIFHCH ETRHAPKRDQ SESDDSVEIL EGIPRSQKAK AIIPDTIEHS  180
VENLGHCPLG QSSKRKRKEG DTENDVSVDM HIKRMEVEKS QENVASPSFT REGKKSNKGC  240
RMQKQQSESV YGPNKAVMDR KSAVAYQRAK AFKSKNPFMT SFMQPSYVFS PFSLSIALKF  300
ARKYFLENYG NLVLRVPGRG RGSWSVKCTT RGTNAKVHSG WKAFVLDNKL KCGDVCVFEV  360
IKGTRLFIDV TIFRAAGSTL MHKIIGEVPG DSDSKSNVFK TDNCVPCSQP KVVHTKKLKQ  420
RKGGSYEEHG EGTEIEHSVE ILGHCPLAHG SKRKRPEGEA EGNVSIDIHT KSINVENTQE  480
HVASPSITRK TKRSGESCRM HKQQSEVVYA KNKTVDKERS IAYQRAKAFT SENPFVIYFM  540
QPSYVSKPYS LHISLLFAVK YFRENCGNLV LRVPGSGSGS WPVKYALGKS KPKICFSWKA  600
FVLDNKLKFG DACVFELIKG GTKPILDVTI FRAAESKPMH KIDAKLAGVS DSKKKTIKTE  660
NSVPCSQPKI VHSRKLNFEK KQRGDSDCFT SKIKEEPSEA AGKHVQQSKS SCKGSAVAKE  720
MVLAYLRAKA FTSENPFFTC FMQPSYVSSA SGPMQLSITL SRARKFFAAK HSDVVLQNSS  780
KRSWAVKCSL GTVNAKLTSG WKEFVLDNNL KVGDVCVFER VSRSKLLFNV IIYTSAEGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A5e-1424837418141B3 domain-containing transcription factor VRN
4i1k_B5e-1424837418141B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-44HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankHG9755141e-44HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016490738.10.0PREDICTED: putative B3 domain-containing protein Os03g0621600 isoform X1
TrEMBLK4B4X60.0K4B4X6_SOLLC; Uncharacterized protein
STRINGSolyc02g021260.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.16e-35B3 family protein